Lineage for d1k28a1 (1k28 A:6-129)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1790288Superfamily b.40.8: gp5 N-terminal domain-like [69255] (1 family) (S)
  5. 1790289Family b.40.8.1: gp4 N-terminal domain-like [69256] (2 proteins)
  6. 1790293Protein Tail-associated lysozyme gp5, N-terminal domain [69257] (1 species)
  7. 1790294Species Bacteriophage T4 [TaxId:10665] [69258] (1 PDB entry)
  8. 1790295Domain d1k28a1: 1k28 A:6-129 [68049]
    Other proteins in same PDB: d1k28a2, d1k28a3, d1k28d1, d1k28d2
    complexed with k, po4

Details for d1k28a1

PDB Entry: 1k28 (more details), 2.9 Å

PDB Description: The Structure of the Bacteriophage T4 Cell-Puncturing Device
PDB Compounds: (A:) Tail-associated lysozyme

SCOPe Domain Sequences for d1k28a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k28a1 b.40.8.1 (A:6-129) Tail-associated lysozyme gp5, N-terminal domain {Bacteriophage T4 [TaxId: 10665]}
nnlnwfvgvvedrmdplklgrvrvrvvglhppqraqgdvmgipteklpwmsviqpitsaa
msgiggsvtgpvegtrvyghfldkwktngivlgtyggivrekpnrlegfsdptgqyprrl
gndt

SCOPe Domain Coordinates for d1k28a1:

Click to download the PDB-style file with coordinates for d1k28a1.
(The format of our PDB-style files is described here.)

Timeline for d1k28a1: