Lineage for d1k25d1 (1k25 D:3632-3692)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598045Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily)
    alpha1-beta3; 2 layers: alpha/beta; order 132
  4. 598046Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (1 family) (S)
    duplication: consists of 2 subdomains of this fold
  5. 598047Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein)
  6. 598048Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species)
  7. 598049Species Streptococcus pneumoniae [TaxId:1313] [54187] (6 PDB entries)
  8. 598066Domain d1k25d1: 1k25 D:3632-3692 [68045]
    Other proteins in same PDB: d1k25a3, d1k25a4, d1k25b3, d1k25b4, d1k25c3, d1k25c4, d1k25d3, d1k25d4

Details for d1k25d1

PDB Entry: 1k25 (more details), 3.2 Å

PDB Description: pbp2x from a highly penicillin-resistant streptococcus pneumoniae clinical isolate

SCOP Domain Sequences for d1k25d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k25d1 d.11.1.1 (D:3632-3692) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Streptococcus pneumoniae}
tessyampsikdispgelaealrrnivqpivvgtgtkiketsveegtnlapnqqvlllsd
k

SCOP Domain Coordinates for d1k25d1:

Click to download the PDB-style file with coordinates for d1k25d1.
(The format of our PDB-style files is described here.)

Timeline for d1k25d1: