Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily) alpha1-beta3; 2 layers: alpha/beta; order 132 |
Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (1 family) duplication: consists of 2 subdomains of this fold |
Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein) |
Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species) |
Species Streptococcus pneumoniae [TaxId:1313] [54187] (6 PDB entries) |
Domain d1k25b1: 1k25 B:1632-1692 [68037] Other proteins in same PDB: d1k25a3, d1k25a4, d1k25b3, d1k25b4, d1k25c3, d1k25c4, d1k25d3, d1k25d4 |
PDB Entry: 1k25 (more details), 3.2 Å
SCOP Domain Sequences for d1k25b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k25b1 d.11.1.1 (B:1632-1692) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} tessyampsikdispgelaealrrnivqpivvgtgtkiketsveegtnlapnqqvlllsd k
Timeline for d1k25b1: