SCOP 1.73: Domain d1k25b1: 1k25 B:1632-1692

Lineage for d1k25b1 (1k25 B:1632-1692)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily)
   alpha1-beta3; 2 layers: alpha/beta; order 132

4. Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (1 family)
   duplication: consists of 2 subdomains of this fold

5. Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein)

6. Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species)

7. Species Streptococcus pneumoniae [TaxId:1313] [54187] (6 PDB entries)

8. Domain d1k25b1: 1k25 B:1632-1692 [68037]
   Other proteins in same PDB: d1k25a3, d1k25a4, d1k25b3, d1k25b4, d1k25c3, d1k25c4, d1k25d3, d1k25d4

Details for d1k25b1

PDB Entry: 1k25, 3.2 Å

PDB Description: pbp2x from a highly penicillin-resistant streptococcus pneumoniae clinical isolate

PDB Compounds: (B:) low-affinity PENICILLIN-BINDING PROTEIN 2X

SCOP Domain Sequences for d1k25b1:

Sequence; same for both SEQRES and ATOM records:

>d1k25b1 d.11.1.1 (B:1632-1692) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Streptococcus pneumoniae [TaxId: 1313]}
tessyampsikdispgelaealrrnivqpivvgtgtkiketsveegtnlapnqqvlllsd
k

Timeline for d1k25b1:

• d1k25b1 first appeared in SCOP 1.59
  
• d1k25b1 appears in SCOP 1.71
  
• d1k25b1 appears in SCOP 1.75
  
• d1k25b1 appears in the current release, SCOPe 2.08