Lineage for d1k25a2 (1k25 A:693-750)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1400983Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily)
    alpha1-beta3; 2 layers: alpha/beta; order 132
  4. 1400984Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (1 family) (S)
    duplication: consists of 2 subdomains of this fold
  5. 1400985Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein)
  6. 1400986Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species)
  7. 1400987Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [54187] (10 PDB entries)
  8. 1401015Domain d1k25a2: 1k25 A:693-750 [68034]
    Other proteins in same PDB: d1k25a3, d1k25a4, d1k25b3, d1k25b4, d1k25c3, d1k25c4, d1k25d3, d1k25d4

Details for d1k25a2

PDB Entry: 1k25 (more details), 3.2 Å

PDB Description: pbp2x from a highly penicillin-resistant streptococcus pneumoniae clinical isolate
PDB Compounds: (A:) low-affinity PENICILLIN-BINDING PROTEIN 2X

SCOPe Domain Sequences for d1k25a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k25a2 d.11.1.1 (A:693-750) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
veeipdmygwkketaetfakwldielefegsgsvvqkqdvrtntaiknikkikltlgd

SCOPe Domain Coordinates for d1k25a2:

Click to download the PDB-style file with coordinates for d1k25a2.
(The format of our PDB-style files is described here.)

Timeline for d1k25a2: