Lineage for d1k23c_ (1k23 C:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 128688Fold c.107: Manganese-dependent inorganic pyrophosphatase (family II) [64181] (1 superfamily)
  4. 128689Superfamily c.107.1: Manganese-dependent inorganic pyrophosphatase (family II) [64182] (1 family) (S)
  5. 128690Family c.107.1.1: Manganese-dependent inorganic pyrophosphatase (family II) [64183] (1 protein)
  6. 128691Protein Manganese-dependent inorganic pyrophosphatase (family II) [64184] (3 species)
  7. 128692Species Bacillus subtilis [TaxId:1423] [69610] (1 PDB entry)
  8. 128695Domain d1k23c_: 1k23 C: [68031]

Details for d1k23c_

PDB Entry: 1k23 (more details), 3 Å

PDB Description: Inorganic Pyrophosphatase (Family II) from Bacillus subtilis

SCOP Domain Sequences for d1k23c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k23c_ c.107.1.1 (C:) Manganese-dependent inorganic pyrophosphatase (family II) {Bacillus subtilis}
mekilifghqnpdtdticsaiayadlknklgfnaepvrlgqvngetqyaldyfkqesprl
vetaanevngvilvdhnerqqsikdieevqvlevidhhrianfetaeplyyraepvgcta
tilnkmykennvkiekeiaglmlsaiisdsllfksptctdqdvaaakelaeiagvdaeey
glnmlkagadlskktveelisldakeftlgskkveiaqvntvdiedvkkrqaeleavisk
vvaeknldlfllvitdilendslalaigneaakvekafnvtlenntallkgvvsrkkqvv
pvltdama

SCOP Domain Coordinates for d1k23c_:

Click to download the PDB-style file with coordinates for d1k23c_.
(The format of our PDB-style files is described here.)

Timeline for d1k23c_: