Lineage for d1k23a_ (1k23 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2166873Fold c.107: DHH phosphoesterases [64181] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 6 strands, order 321456
    Domain 2 has mixed sheet of 5 strands, order 12345; strands 1 & 4 are antiparallel to the rest
  4. 2166874Superfamily c.107.1: DHH phosphoesterases [64182] (3 families) (S)
    constituent families have similar domain organization with variable interdomain linker and spatial arrangement of the domains
  5. 2166875Family c.107.1.1: Manganese-dependent inorganic pyrophosphatase (family II) [64183] (2 proteins)
  6. 2166876Protein Manganese-dependent inorganic pyrophosphatase (family II) [64184] (3 species)
  7. 2166877Species Bacillus subtilis [TaxId:1423] [69610] (5 PDB entries)
    Uniprot P37487
  8. 2166886Domain d1k23a_: 1k23 A: [68029]
    complexed with mn

Details for d1k23a_

PDB Entry: 1k23 (more details), 3 Å

PDB Description: Inorganic Pyrophosphatase (Family II) from Bacillus subtilis
PDB Compounds: (A:) Manganese-dependent inorganic pyrophosphatase

SCOPe Domain Sequences for d1k23a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k23a_ c.107.1.1 (A:) Manganese-dependent inorganic pyrophosphatase (family II) {Bacillus subtilis [TaxId: 1423]}
mekilifghqnpdtdticsaiayadlknklgfnaepvrlgqvngetqyaldyfkqesprl
vetaanevngvilvdhnerqqsikdieevqvlevidhhrianfetaeplyyraepvgcta
tilnkmykennvkiekeiaglmlsaiisdsllfksptctdqdvaaakelaeiagvdaeey
glnmlkagadlskktveelisldakeftlgskkveiaqvntvdiedvkkrqaeleavisk
vvaeknldlfllvitdilendslalaigneaakvekafnvtlenntallkgvvsrkkqvv
pvltdam

SCOPe Domain Coordinates for d1k23a_:

Click to download the PDB-style file with coordinates for d1k23a_.
(The format of our PDB-style files is described here.)

Timeline for d1k23a_: