Lineage for d1k23a_ (1k23 A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.107: DHH phosphoesterases [64181] (1 superfamily) Superfamily c.107.1: DHH phosphoesterases [64182] (2 families) 
Family c.107.1.1: Manganese-dependent inorganic pyrophosphatase (family II) [64183] (1 protein) Protein Manganese-dependent inorganic pyrophosphatase (family II) [64184] (3 species) 
Species Bacillus subtilis [TaxId:1423] [69610] (1 PDB entry) 
Domain d1k23a_: 1k23 A: [68029]
Details for d1k23a_
PDB Entry: 1k23 (more details), 3 Å
PDB Description: Inorganic Pyrophosphatase (Family II) from Bacillus subtilis
SCOP Domain Sequences for d1k23a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k23a_ c.107.1.1 (A:) Manganese-dependent inorganic pyrophosphatase (family II) {Bacillus subtilis}
mekilifghqnpdtdticsaiayadlknklgfnaepvrlgqvngetqyaldyfkqesprl
vetaanevngvilvdhnerqqsikdieevqvlevidhhrianfetaeplyyraepvgcta
tilnkmykennvkiekeiaglmlsaiisdsllfksptctdqdvaaakelaeiagvdaeey
glnmlkagadlskktveelisldakeftlgskkveiaqvntvdiedvkkrqaeleavisk
vvaeknldlfllvitdilendslalaigneaakvekafnvtlenntallkgvvsrkkqvv
pvltdam
SCOP Domain Coordinates for d1k23a_:
Click to download the PDB-style file with coordinates for d1k23a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k23a_:
- d1k23a_ first appeared in SCOP 1.59
- d1k23a_ appears in SCOP 1.63
- d1k23a_ appears in the current release, SCOPe 2.08
View in 3D
