![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.107: DHH phosphoesterases [64181] (1 superfamily) consists of two non-similar domains Domain 1 has parallel sheet of 6 strands, order 321456 Domain 2 has mixed sheet of 5 strands, order 12345; strands 1 & 4 are antiparallel to the rest |
![]() | Superfamily c.107.1: DHH phosphoesterases [64182] (3 families) ![]() constituent families have similar domain organization with variable interdomain linker and spatial arrangement of the domains |
![]() | Family c.107.1.1: Manganese-dependent inorganic pyrophosphatase (family II) [64183] (2 proteins) |
![]() | Protein Manganese-dependent inorganic pyrophosphatase (family II) [64184] (3 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [69610] (5 PDB entries) Uniprot P37487 |
![]() | Domain d1k23a_: 1k23 A: [68029] complexed with mn |
PDB Entry: 1k23 (more details), 3 Å
SCOPe Domain Sequences for d1k23a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k23a_ c.107.1.1 (A:) Manganese-dependent inorganic pyrophosphatase (family II) {Bacillus subtilis [TaxId: 1423]} mekilifghqnpdtdticsaiayadlknklgfnaepvrlgqvngetqyaldyfkqesprl vetaanevngvilvdhnerqqsikdieevqvlevidhhrianfetaeplyyraepvgcta tilnkmykennvkiekeiaglmlsaiisdsllfksptctdqdvaaakelaeiagvdaeey glnmlkagadlskktveelisldakeftlgskkveiaqvntvdiedvkkrqaeleavisk vvaeknldlfllvitdilendslalaigneaakvekafnvtlenntallkgvvsrkkqvv pvltdam
Timeline for d1k23a_: