Lineage for d1k1za_ (1k1z A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796151Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 796152Family b.34.2.1: SH3-domain [50045] (39 proteins)
  6. 796459Protein Vav N-terminal SH3 domain [63744] (1 species)
  7. 796460Species Mouse (Mus musculus) [TaxId:10090] [63745] (3 PDB entries)
  8. 796466Domain d1k1za_: 1k1z A: [68026]
    mutant

Details for d1k1za_

PDB Entry: 1k1z (more details)

PDB Description: Solution structure of N-terminal SH3 domain mutant(P33G) of murine Vav
PDB Compounds: (A:) vav

SCOP Domain Sequences for d1k1za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k1za_ b.34.2.1 (A:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]}
raqdkkrnelglpkmevfqeyygippppgafggflrlnpgdiveltkaeaehnwwegrnt
atnevgwfpcnrvhpyvh

SCOP Domain Coordinates for d1k1za_:

Click to download the PDB-style file with coordinates for d1k1za_.
(The format of our PDB-style files is described here.)

Timeline for d1k1za_: