Lineage for d1k1za_ (1k1z A:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.34: SH3-like barrel [50036] (9 superfamilies) 
Superfamily b.34.2: SH3-domain [50044] (1 family) 
Family b.34.2.1: SH3-domain [50045] (20 proteins) 
Protein Vav N-terminal SH3 domain [63744] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [63745] (3 PDB entries) 
Domain d1k1za_: 1k1z A: [68026]
Details for d1k1za_
PDB Entry: 1k1z (more details)
PDB Description: solution structure of n-terminal sh3 domain mutant(p33g) of murine vav
SCOP Domain Sequences for d1k1za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k1za_ b.34.2.1 (A:) Vav N-terminal SH3 domain {Mouse (Mus musculus)}
raqdkkrnelglpkmevfqeyygippppgafggflrlnpgdiveltkaeaehnwwegrnt
atnevgwfpcnrvhpyvh
SCOP Domain Coordinates for d1k1za_:
Click to download the PDB-style file with coordinates for d1k1za_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k1za_:
- d1k1za_ is new in SCOP 1.59
- d1k1za_ appears in SCOP 1.61
- d1k1za_ appears in the current release, SCOPe 2.08
View in 3D