Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein Vav N-terminal SH3 domain [63744] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [63745] (3 PDB entries) |
Domain d1k1za_: 1k1z A: [68026] mutant |
PDB Entry: 1k1z (more details)
SCOPe Domain Sequences for d1k1za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k1za_ b.34.2.1 (A:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} raqdkkrnelglpkmevfqeyygippppgafggflrlnpgdiveltkaeaehnwwegrnt atnevgwfpcnrvhpyvh
Timeline for d1k1za_: