Lineage for d1k1pa_ (1k1p A:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (36 proteins) Protein Trypsin(ogen) [50515] (7 species) 
Species Cow (Bos taurus) [TaxId:9913] [50516] (147 PDB entries) 
Domain d1k1pa_: 1k1p A: [68022]
Details for d1k1pa_
PDB Entry: 1k1p (more details), 1.9 Å
PDB Description: bovine trypsin-inhibitor complex
SCOP Domain Sequences for d1k1pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k1pa_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
SCOP Domain Coordinates for d1k1pa_:
Click to download the PDB-style file with coordinates for d1k1pa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k1pa_:
- d1k1pa_ is new in SCOP 1.59
- d1k1pa_ appears in SCOP 1.61
- d1k1pa_ appears in the current release, SCOPe 2.08
View in 3D