SCOP 1.69: Domain d1k1ma_: 1k1m A:

Lineage for d1k1ma_ (1k1m A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins)

6. Protein Trypsin(ogen) [50515] (8 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (229 PDB entries)

8. Domain d1k1ma_: 1k1m A: [68019]

Details for d1k1ma_

PDB Entry: 1k1m, 2.2 Å

PDB Description: bovine trypsin-inhibitor complex

SCOP Domain Sequences for d1k1ma_:

Sequence; same for both SEQRES and ATOM records:

>d1k1ma_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1k1ma_:

• d1k1ma_ first appeared in SCOP 1.59
  
• d1k1ma_ appears in SCOP 1.67
  
• d1k1ma_ appears in SCOP 1.71
  
• d1k1ma_ appears in the current release, SCOPe 2.08