Lineage for d1k1ia_ (1k1i A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 953177Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 953999Protein Trypsin(ogen) [50515] (9 species)
  7. 954017Species Cow (Bos taurus) [TaxId:9913] [50516] (340 PDB entries)
    Uniprot P00760
  8. 954321Domain d1k1ia_: 1k1i A: [68016]
    complexed with ca, fd1

Details for d1k1ia_

PDB Entry: 1k1i (more details), 2.2 Å

PDB Description: bovine trypsin-inhibitor complex
PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d1k1ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k1ia_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d1k1ia_:

Click to download the PDB-style file with coordinates for d1k1ia_.
(The format of our PDB-style files is described here.)

Timeline for d1k1ia_: