Lineage for d1k1fe_ (1k1f E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013337Fold a.147: Bcr-Abl oncoprotein oligomerization domain [69035] (1 superfamily)
    core: 4 long helices; bundle
  4. 2013338Superfamily a.147.1: Bcr-Abl oncoprotein oligomerization domain [69036] (1 family) (S)
    homotetramer
    automatically mapped to Pfam PF09036
  5. 2013339Family a.147.1.1: Bcr-Abl oncoprotein oligomerization domain [69037] (1 protein)
  6. 2013340Protein Bcr-Abl oncoprotein oligomerization domain [69038] (1 species)
  7. 2013341Species Human (Homo sapiens) [TaxId:9606] [69039] (1 PDB entry)
  8. 2013346Domain d1k1fe_: 1k1f E: [68011]

Details for d1k1fe_

PDB Entry: 1k1f (more details), 2.2 Å

PDB Description: Structure of the Bcr-Abl Oncoprotein Oligomerization domain
PDB Compounds: (E:) breakpoint cluster region protein

SCOPe Domain Sequences for d1k1fe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k1fe_ a.147.1.1 (E:) Bcr-Abl oncoprotein oligomerization domain {Human (Homo sapiens) [TaxId: 9606]}
dpvgfaeawkaqfpdsepprmelrsvgdieqelerakasirrleqevnqerfrmiylqtl
lakek

SCOPe Domain Coordinates for d1k1fe_:

Click to download the PDB-style file with coordinates for d1k1fe_.
(The format of our PDB-style files is described here.)

Timeline for d1k1fe_: