Lineage for d1k1el_ (1k1e L:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148571Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2148572Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2148755Family c.108.1.5: Probable phosphatase YrbI [69467] (1 protein)
    the insertion subdomain is a beta-hairpin involved into tetramerisation
  6. 2148756Protein Probable phosphatase YrbI [69468] (1 species)
  7. 2148757Species Haemophilus influenzae, HI1679 [TaxId:727] [69469] (2 PDB entries)
  8. 2148769Domain d1k1el_: 1k1e L: [68006]
    complexed with co, gol, hg, mes, so4

Details for d1k1el_

PDB Entry: 1k1e (more details), 1.67 Å

PDB Description: Structure Of the cobalt-bound form of the deoxy-D-mannose-octulosonate 8-phosphate phosphatase (YrbI) From Haemophilus Influenzae (HI1679)
PDB Compounds: (L:) deoxy-D-mannose-octulosonate 8-phosphate phosphatase

SCOPe Domain Sequences for d1k1el_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k1el_ c.108.1.5 (L:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]}
klenikfvitdvdgvltdgqlhydangeaiksfhvrdglgikmlmdadiqvavlsgrdsp
ilrrriadlgiklfflgkleketacfdlmkqagvtaeqtayigddsvdlpafaacgtsfa
vadapiyvknavdhvlsthggkgafremsdmilqaqgkssvfdtaqgflk

SCOPe Domain Coordinates for d1k1el_:

Click to download the PDB-style file with coordinates for d1k1el_.
(The format of our PDB-style files is described here.)

Timeline for d1k1el_: