Lineage for d1k1ef_ (1k1e F:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 128703Fold c.108: HAD-like [56783] (1 superfamily)
  4. 128704Superfamily c.108.1: HAD-like [56784] (5 families) (S)
  5. 128746Family c.108.1.5: Probable phosphatase YrbI [69467] (1 protein)
  6. 128747Protein Probable phosphatase YrbI [69468] (1 species)
  7. 128748Species Haemophilus influenzae, HI1679 [TaxId:727] [69469] (2 PDB entries)
  8. 128754Domain d1k1ef_: 1k1e F: [68000]

Details for d1k1ef_

PDB Entry: 1k1e (more details), 1.67 Å

PDB Description: Structure Of the cobalt-bound form of the deoxy-D-mannose-octulosonate 8-phosphate phosphatase (YrbI) From Haemophilus Influenzae (HI1679)

SCOP Domain Sequences for d1k1ef_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k1ef_ c.108.1.5 (F:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679}
klenikfvitdvdgvltdgqlhydangeaiksfhvrdglgikmlmdadiqvavlsgrdsp
ilrrriadlgiklfflgkleketacfdlmkqagvtaeqtayigddsvdlpafaacgtsfa
vadapiyvknavdhvlsthggkgafremsdmilqaqgkssvfdtaqgflksvksmgq

SCOP Domain Coordinates for d1k1ef_:

Click to download the PDB-style file with coordinates for d1k1ef_.
(The format of our PDB-style files is described here.)

Timeline for d1k1ef_: