Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.94: HPr-like [55593] (2 superfamilies) beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423 |
Superfamily d.94.1: HPr-like [55594] (1 family) |
Family d.94.1.1: HPr-like [55595] (2 proteins) |
Protein Crh, catabolite repression HPr-like protein [69783] (1 species) |
Species Bacillus subtilis [TaxId:1423] [69784] (3 PDB entries) |
Domain d1k1ca_: 1k1c A: [67994] |
PDB Entry: 1k1c (more details)
SCOP Domain Sequences for d1k1ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k1ca_ d.94.1.1 (A:) Crh, catabolite repression HPr-like protein {Bacillus subtilis} vqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgtev tliaqgedeqealeklaayvqeev
Timeline for d1k1ca_: