Lineage for d1k1ca_ (1k1c A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 608326Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 608327Superfamily d.94.1: HPr-like [55594] (1 family) (S)
  5. 608328Family d.94.1.1: HPr-like [55595] (2 proteins)
  6. 608329Protein Crh, catabolite repression HPr-like protein [69783] (1 species)
  7. 608330Species Bacillus subtilis [TaxId:1423] [69784] (3 PDB entries)
  8. 608337Domain d1k1ca_: 1k1c A: [67994]

Details for d1k1ca_

PDB Entry: 1k1c (more details)

PDB Description: solution structure of crh, the bacillus subtilis catabolite repression hpr

SCOP Domain Sequences for d1k1ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k1ca_ d.94.1.1 (A:) Crh, catabolite repression HPr-like protein {Bacillus subtilis}
vqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgtev
tliaqgedeqealeklaayvqeev

SCOP Domain Coordinates for d1k1ca_:

Click to download the PDB-style file with coordinates for d1k1ca_.
(The format of our PDB-style files is described here.)

Timeline for d1k1ca_: