Lineage for d1k1aa_ (1k1a A:)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.118: alpha-alpha superhelix [48370] (13 superfamilies) 
Superfamily a.118.2: Ankyrin repeat [48403] (1 family) 
Family a.118.2.1: Ankyrin repeat [48404] (10 proteins) 
Protein bcl-3 [69091] (1 species) Species Human (Homo sapiens) [TaxId:9606] [69092] (2 PDB entries) 
Domain d1k1aa_: 1k1a A: [67992]
Details for d1k1aa_
PDB Entry: 1k1a (more details), 1.86 Å
PDB Description: Crystal structure of the ankyrin repeat domain of Bcl-3: a unique member of the IkappaB protein family
SCOP Domain Sequences for d1k1aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k1aa_ a.118.2.1 (A:) bcl-3 {Human (Homo sapiens)}
edgdtplhiavvqgnlpavhrlvnlfqqggreldiynnlrqtplhlavittlpsvvrllv
tagaspmaldrhgqtaahlacehrsptclralldsaapgtldlearnydgltalhvavnt
ecqetvqlllergadidavdiksgrsplihavennslsmvqlllqhganvnaqmysgssa
lhsasgrgllplvrtlvrsgadsslknchndtplmvarsrrvidilrg
SCOP Domain Coordinates for d1k1aa_:
Click to download the PDB-style file with coordinates for d1k1aa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k1aa_:
- d1k1aa_ is new in SCOP 1.59
- d1k1aa_ appears in SCOP 1.61
- d1k1aa_ appears in the current release, SCOPe 2.08
View in 3D