SCOPe 2.06: Domain d1k0va1: 1k0v A:1-69

Lineage for d1k0va1 (1k0v A:1-69)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families)

5. Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)

6. Protein Copper chaperone [55017] (3 species)

7. Species Bacillus subtilis, CopZ [TaxId:1423] [69736] (2 PDB entries)

8. Domain d1k0va1: 1k0v A:1-69 [67986]
   Other proteins in same PDB: d1k0va2
   complexed with cu1

Details for d1k0va1

PDB Entry: 1k0v

PDB Description: copper trafficking: the solution structure of bacillus subtilis copz

PDB Compounds: (A:) CopZ

SCOPe Domain Sequences for d1k0va1:

Sequence; same for both SEQRES and ATOM records:

>d1k0va1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]}
meqktlqvegmscqhcvkavetsvgeldgvsavhvnleagkvdvsfdadkvsvkdiadai
edqgydvak

Timeline for d1k0va1:

• d1k0va1 first appeared in SCOP 1.59, called d1k0va_
  
• d1k0va1 was called d1k0va_ in SCOPe 2.05
  
• d1k0va1 appears in SCOPe 2.07
  
• d1k0va1 appears in the current release, SCOPe 2.08