SCOPe 2.08: Domain d1k0uh2: 1k0u H:2-189,H:353-431

Lineage for d1k0uh2 (1k0u H:2-189,H:353-431)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families)

5. Family c.23.12.3: S-adenosylhomocystein hydrolase [52300] (1 protein)

6. Protein S-adenosylhomocystein hydrolase [52301] (3 species)
   contains additional secondary structures disguising the superfamily fold

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [52303] (7 PDB entries)

8. Domain d1k0uh2: 1k0u H:2-189,H:353-431 [67985]
   Other proteins in same PDB: d1k0ua1, d1k0ub1, d1k0uc1, d1k0ud1, d1k0ue1, d1k0uf1, d1k0ug1, d1k0uh1
   complexed with dea, nad

Details for d1k0uh2

PDB Entry: 1k0u, 3 Å

PDB Description: Inhibition of S-adenosylhomocysteine Hydrolase by "acyclic sugar" Adenosine Analogue D-eritadenine

PDB Compounds: (H:) s-adenosyl-l-homocysteine hydrolase

SCOPe Domain Sequences for d1k0uh2:

Sequence; same for both SEQRES and ATOM records:

>d1k0uh2 c.23.12.3 (H:2-189,H:353-431) S-adenosylhomocystein hydrolase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
svtkskfdXpsfvmsnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnv
kltkltekqaqylgmpingpfkpdhyry

Timeline for d1k0uh2:

• d1k0uh2 first appeared in SCOP 1.59
  
• d1k0uh2 appears in SCOPe 2.07