Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) |
Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins) this domain interrupts the other domain which defines family |
Protein S-adenosylhomocystein hydrolase [51845] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [51847] (6 PDB entries) |
Domain d1k0ug1: 1k0u G:190-352 [67982] Other proteins in same PDB: d1k0ua2, d1k0ub2, d1k0uc2, d1k0ud2, d1k0ue2, d1k0uf2, d1k0ug2, d1k0uh2 |
PDB Entry: 1k0u (more details), 3 Å
SCOP Domain Sequences for d1k0ug1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k0ug1 c.2.1.4 (G:190-352) S-adenosylhomocystein hydrolase {Rat (Rattus norvegicus)} nlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviiteidpinal qaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighfdveidvkw lnenavekvnikpqvdryllknghriillaegrlvnlgcamgh
Timeline for d1k0ug1: