Lineage for d1k0uc2 (1k0u C:2-189,C:353-431)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 241017Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 241529Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 241587Family c.23.12.3: S-adenosylhomocystein hydrolase [52300] (1 protein)
  6. 241588Protein S-adenosylhomocystein hydrolase [52301] (2 species)
    contains additional secondary structures disguising the superfamily fold
  7. 241592Species Rat (Rattus norvegicus) [TaxId:10116] [52303] (6 PDB entries)
  8. 241599Domain d1k0uc2: 1k0u C:2-189,C:353-431 [67975]
    Other proteins in same PDB: d1k0ua1, d1k0ub1, d1k0uc1, d1k0ud1, d1k0ue1, d1k0uf1, d1k0ug1, d1k0uh1

Details for d1k0uc2

PDB Entry: 1k0u (more details), 3 Å

PDB Description: Inhibition of S-adenosylhomocysteine Hydrolase by "acyclic sugar" Adenosine Analogue D-eritadenine

SCOP Domain Sequences for d1k0uc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k0uc2 c.23.12.3 (C:2-189,C:353-431) S-adenosylhomocystein hydrolase {Rat (Rattus norvegicus)}
dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
svtkskfdXpsfvmsnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnv
kltkltekqaqylgmpingpfkpdhyry

SCOP Domain Coordinates for d1k0uc2:

Click to download the PDB-style file with coordinates for d1k0uc2.
(The format of our PDB-style files is described here.)

Timeline for d1k0uc2: