Lineage for d1k0sa_ (1k0s A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 110053Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 110993Superfamily b.40.7: CheW-like [50341] (1 family) (S)
  5. 110994Family b.40.7.1: CheW-like [50342] (2 protein domains)
  6. 110995Protein Chemotaxis protein CheW [69271] (1 species)
  7. 110996Species Thermotoga maritima [TaxId:243274] [69272] (1 PDB entry)
  8. 110997Domain d1k0sa_: 1k0s A: [67969]

Details for d1k0sa_

PDB Entry: 1k0s (more details)

PDB Description: Solution structure of the chemotaxis protein CheW from the thermophilic organism Thermotoga maritima

SCOP Domain Sequences for d1k0sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k0sa_ b.40.7.1 (A:) Chemotaxis protein CheW {Thermotoga maritima}
mktladalkefevlsfeideqalafdvdniemvieksditpvpksrhfvegvinlrgrii
pvvnlakilgisfdeqkmksiivartkdvevgflvdrvlgvlritenqldltnvsdkfgk
kskglvktdgrliiyldidkiieeitvkegv

SCOP Domain Coordinates for d1k0sa_:

Click to download the PDB-style file with coordinates for d1k0sa_.
(The format of our PDB-style files is described here.)

Timeline for d1k0sa_: