Lineage for d1k0sa_ (1k0s A:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.40: OB-fold [50198] (8 superfamilies) 
Superfamily b.40.7: CheW-like [50341] (1 family) 
Family b.40.7.1: CheW-like [50342] (2 proteins) 
Protein Chemotaxis protein CheW [69271] (1 species) Species Thermotoga maritima [TaxId:243274] [69272] (1 PDB entry) 
Domain d1k0sa_: 1k0s A: [67969]
Details for d1k0sa_
PDB Entry: 1k0s (more details)
PDB Description: solution structure of the chemotaxis protein chew from the thermophilic organism thermotoga maritima
SCOP Domain Sequences for d1k0sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k0sa_ b.40.7.1 (A:) Chemotaxis protein CheW {Thermotoga maritima}
mktladalkefevlsfeideqalafdvdniemvieksditpvpksrhfvegvinlrgrii
pvvnlakilgisfdeqkmksiivartkdvevgflvdrvlgvlritenqldltnvsdkfgk
kskglvktdgrliiyldidkiieeitvkegv
SCOP Domain Coordinates for d1k0sa_:
Click to download the PDB-style file with coordinates for d1k0sa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k0sa_:
- d1k0sa_ is new in SCOP 1.59
- d1k0sa_ appears in SCOP 1.61
- d1k0sa_ appears in the current release, SCOPe 2.08
View in 3D