Lineage for d1k0rb1 (1k0r B:108-183)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399296Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2399715Protein S1 domain of NusA [69265] (2 species)
  7. 2399716Species Mycobacterium tuberculosis [TaxId:1773] [69267] (3 PDB entries)
  8. 2399719Domain d1k0rb1: 1k0r B:108-183 [67965]
    Other proteins in same PDB: d1k0ra2, d1k0ra3, d1k0ra4, d1k0ra5, d1k0rb2, d1k0rb3, d1k0rb4, d1k0rb5
    complexed with so4

Details for d1k0rb1

PDB Entry: 1k0r (more details), 1.7 Å

PDB Description: Crystal Structure of Mycobacterium tuberculosis NusA
PDB Compounds: (B:) NusA

SCOPe Domain Sequences for d1k0rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k0rb1 b.40.4.5 (B:108-183) S1 domain of NusA {Mycobacterium tuberculosis [TaxId: 1773]}
stregeivagviqrdsranarglvvvrigtetkasegvipaaeqvpgesyehgnrlrcyv
vgvtrgareplitlsr

SCOPe Domain Coordinates for d1k0rb1:

Click to download the PDB-style file with coordinates for d1k0rb1.
(The format of our PDB-style files is described here.)

Timeline for d1k0rb1: