| Class b: All beta proteins [48724] (165 folds) |
| Fold b.40: OB-fold [50198] (12 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) ![]() |
| Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins) barrel, closed; n=5, S=8 |
| Protein S1 domain of NusA [69265] (2 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [69267] (3 PDB entries) |
| Domain d1k0rb1: 1k0r B:108-183 [67965] Other proteins in same PDB: d1k0ra2, d1k0ra3, d1k0ra4, d1k0rb2, d1k0rb3, d1k0rb4 complexed with so4 |
PDB Entry: 1k0r (more details), 1.7 Å
SCOP Domain Sequences for d1k0rb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k0rb1 b.40.4.5 (B:108-183) S1 domain of NusA {Mycobacterium tuberculosis [TaxId: 1773]}
stregeivagviqrdsranarglvvvrigtetkasegvipaaeqvpgesyehgnrlrcyv
vgvtrgareplitlsr
Timeline for d1k0rb1:
View in 3DDomains from other chains: (mouse over for more information) d1k0ra1, d1k0ra2, d1k0ra3, d1k0ra4 |