Lineage for d1k0ra2 (1k0r A:184-262)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411467Fold d.52: Alpha-lytic protease prodomain-like [54805] (7 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 411494Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 411495Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 411520Protein Transcription factor NusA, C-terminal domains [69701] (2 species)
    duplication: tandem repeat of two type II KH-domains
  7. 411521Species Mycobacterium tuberculosis [TaxId:1773] [69703] (1 PDB entry)
  8. 411522Domain d1k0ra2: 1k0r A:184-262 [67962]
    Other proteins in same PDB: d1k0ra1, d1k0ra4, d1k0rb1, d1k0rb4

Details for d1k0ra2

PDB Entry: 1k0r (more details), 1.7 Å

PDB Description: Crystal Structure of Mycobacterium tuberculosis NusA

SCOP Domain Sequences for d1k0ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k0ra2 d.52.3.1 (A:184-262) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis}
thpnlvrklfslevpeiadgsveivavareaghrskiavrsnvaglnakgacigpmgqrv
rnvmselsgekidiidydd

SCOP Domain Coordinates for d1k0ra2:

Click to download the PDB-style file with coordinates for d1k0ra2.
(The format of our PDB-style files is described here.)

Timeline for d1k0ra2: