![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) ![]() alpha-beta(2)-alpha-beta(5)-alpha |
![]() | Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins) automatically mapped to Pfam PF00235 |
![]() | Protein Profilin (actin-binding protein) [55772] (8 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55777] (2 PDB entries) |
![]() | Domain d1k0ka_: 1k0k A: [67946] complexed with gol |
PDB Entry: 1k0k (more details), 2.35 Å
SCOPe Domain Sequences for d1k0ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k0ka_ d.110.1.1 (A:) Profilin (actin-binding protein) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} swqaytdnligtgkvdkaviysragdavwatsgglslqpneigeivqgfdnpaglqsngl hiqgqkfmllraddrsiygrhdaegvvcvrtkqtviiahypptvqageatkiveqladyl igvqy
Timeline for d1k0ka_: