Lineage for d1k0ja2 (1k0j A:174-275)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) 
Family d.16.1.2: PHBH-like [54378] (2 proteins) Protein p-Hydroxybenzoate hydroxylase (PHBH) [54379] (2 species) Species Pseudomonas aeruginosa [TaxId:287] [54381] (17 PDB entries) 
Domain d1k0ja2: 1k0j A:174-275 [67945]
Other proteins in same PDB: d1k0ja1
Details for d1k0ja2
PDB Entry: 1k0j (more details), 2.2 Å
PDB Description: pseudomonas aeruginosa phbh r220q in complex with nadph and free of p- ohb
SCOP Domain Sequences for d1k0ja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k0ja2 d.16.1.2 (A:174-275) p-Hydroxybenzoate hydroxylase (PHBH) {Pseudomonas aeruginosa}
lkvfervypfgwlglladtppvsheliyanhprgfalcsqrsatrsqyyvqvplsekved
wsderfwtelkarlpsevaeklvtgpsleksiaplrsfvvep
SCOP Domain Coordinates for d1k0ja2:
Click to download the PDB-style file with coordinates for d1k0ja2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k0ja2:
- d1k0ja2 is new in SCOP 1.59
- d1k0ja2 appears in SCOP 1.61
- d1k0ja2 appears in the current release, SCOPe 2.08
View in 3D
