Lineage for d1k0ja1 (1k0j A:1-173,A:276-394)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1832628Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1832629Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 1832683Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 1832894Protein p-Hydroxybenzoate hydroxylase, PHBH [51917] (2 species)
  7. 1832895Species Pseudomonas aeruginosa [TaxId:287] [51919] (18 PDB entries)
  8. 1832911Domain d1k0ja1: 1k0j A:1-173,A:276-394 [67944]
    Other proteins in same PDB: d1k0ja2
    complexed with fad, ndp, so4

Details for d1k0ja1

PDB Entry: 1k0j (more details), 2.2 Å

PDB Description: pseudomonas aeruginosa phbh r220q in complex with nadph and free of p- ohb
PDB Compounds: (A:) p-hydroxybenzoate hydroxylase

SCOPe Domain Sequences for d1k0ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k0ja1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]}
mktqvaiigagpsglllgqllhkagidnvilerqtpdyvlgriragvleqgmvdllreag
vdrrmardglvhegveiafagqrrridlkrlsggktvtvygqtevtrdlmeareacgatt
vyqaaevrlhdlqgerpyvtferdgerlrldcdyiagcdgfhgisrqsipaerXmqhgrl
flagdaahivpptgakglnlaasdvstlyrlllkayregrgellerysaiclrriwkaer
fswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglpyeeie

SCOPe Domain Coordinates for d1k0ja1:

Click to download the PDB-style file with coordinates for d1k0ja1.
(The format of our PDB-style files is described here.)

Timeline for d1k0ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k0ja2