Lineage for d1k0ia2 (1k0i A:174-275)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 854919Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 854920Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 854987Family d.16.1.2: PHBH-like [54378] (4 proteins)
  6. 854996Protein p-Hydroxybenzoate hydroxylase (PHBH) [54379] (2 species)
  7. 854997Species Pseudomonas aeruginosa [TaxId:287] [54381] (18 PDB entries)
  8. 854998Domain d1k0ia2: 1k0i A:174-275 [67943]
    Other proteins in same PDB: d1k0ia1
    complexed with fad, phb, so3, so4; mutant

Details for d1k0ia2

PDB Entry: 1k0i (more details), 1.8 Å

PDB Description: pseudomonas aeruginosa phbh r220q in complex with 100mm phb
PDB Compounds: (A:) p-hydroxybenzoate hydroxylase

SCOP Domain Sequences for d1k0ia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k0ia2 d.16.1.2 (A:174-275) p-Hydroxybenzoate hydroxylase (PHBH) {Pseudomonas aeruginosa [TaxId: 287]}
lkvfervypfgwlglladtppvsheliyanhprgfalcsqrsatrsqyyvqvplsekved
wsderfwtelkarlpsevaeklvtgpsleksiaplrsfvvep

SCOP Domain Coordinates for d1k0ia2:

Click to download the PDB-style file with coordinates for d1k0ia2.
(The format of our PDB-style files is described here.)

Timeline for d1k0ia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k0ia1