Lineage for d1k0dc1 (1k0d C:201-354)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97949Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 97950Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 97951Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 98224Protein Yeast prion protein ure2p, nitrogen regulation fragment [47641] (1 species)
  7. 98225Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47642] (8 PDB entries)
  8. 98228Domain d1k0dc1: 1k0d C:201-354 [67934]
    Other proteins in same PDB: d1k0da2, d1k0db2, d1k0dc2, d1k0dd2

Details for d1k0dc1

PDB Entry: 1k0d (more details), 2.2 Å

PDB Description: Ure2p in Complex with Glutathione

SCOP Domain Sequences for d1k0dc1:

Sequence, based on SEQRES records: (download)

>d1k0dc1 a.45.1.1 (C:201-354) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae)}
lwsddladqsqinawlffqtsghapmigqalhfryfhsqkiasaverytdevrrvygvve
malaerrealvmeldtenaaaysagttpmsqsrffdypvwlvgdkltiadlafvpwnnvv
driginikiefpevykwtkhmmrrpavikalrge

Sequence, based on observed residues (ATOM records): (download)

>d1k0dc1 a.45.1.1 (C:201-354) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae)}
lwsddladqsqinawlffqtsghapmigqalhfryfhsqkiasaverytdevrrvygvve
malaerrealvmelqsrffdypvwlvgdkltiadlafvpwnnvvdriginikiefpevyk
wtkhmmrrpavikalrge

SCOP Domain Coordinates for d1k0dc1:

Click to download the PDB-style file with coordinates for d1k0dc1.
(The format of our PDB-style files is described here.)

Timeline for d1k0dc1: