Lineage for d1k0ca1 (1k0c A:201-351)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1996614Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 protein domains)
  6. 1997193Protein Yeast prion protein ure2p, nitrogen regulation fragment [47641] (1 species)
    similar to class phi enzymes
  7. 1997194Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47642] (8 PDB entries)
  8. 1997211Domain d1k0ca1: 1k0c A:201-351 [67922]
    Other proteins in same PDB: d1k0ca2, d1k0cb2, d1k0cc2, d1k0cd2
    complexed with gsh, gtb

Details for d1k0ca1

PDB Entry: 1k0c (more details), 2.5 Å

PDB Description: Ure2p in complex with S-p-nitrobenzylglutathione
PDB Compounds: (A:) ure2 protein

SCOPe Domain Sequences for d1k0ca1:

Sequence, based on SEQRES records: (download)

>d1k0ca1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lwsddladqsqinawlffqtsghapmigqalhfryfhsqkiasaverytdevrrvygvve
malaerrealvmeldtenaaaysagttpmsqsrffdypvwlvgdkltiadlafvpwnnvv
driginikiefpevykwtkhmmrrpavikal

Sequence, based on observed residues (ATOM records): (download)

>d1k0ca1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lwsddladqsqinawlffqtsghapmigqalhfryfhsqkiasaverytdevrrvygvve
malaerrealvmfdypvwlvgdkltiadlafvpwnnvvdriginikiefpevykwtkhmm
rrpavikal

SCOPe Domain Coordinates for d1k0ca1:

Click to download the PDB-style file with coordinates for d1k0ca1.
(The format of our PDB-style files is described here.)

Timeline for d1k0ca1: