Lineage for d1k06a_ (1k06 A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 127691Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
  4. 127692Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (5 families) (S)
  5. 127720Family c.87.1.4: Oligosaccharide phosphorylase [53766] (2 proteins)
  6. 127721Protein Glycogen phosphorylase [53767] (3 species)
  7. 127733Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53769] (48 PDB entries)
  8. 127738Domain d1k06a_: 1k06 A: [67908]

Details for d1k06a_

PDB Entry: 1k06 (more details), 1.8 Å

PDB Description: Crystallographic Binding Study of 100 mM N-benzoyl-N'-beta-D-glucopyranosyl urea to glycogen phosphorylase b

SCOP Domain Sequences for d1k06a_:

Sequence, based on SEQRES records: (download)

>d1k06a_ c.87.1.4 (A:) Glycogen phosphorylase {Rabbit (Oryctolagus cuniculus)}
isvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtqq
hyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedaglg
ngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpweka
rpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapndf
nlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfk
sskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktc
aytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslve
egavkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngitprrwl
vlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylere
ykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapg
yhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagte
asgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyy
dripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyk
nprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpap

Sequence, based on observed residues (ATOM records): (download)

>d1k06a_ c.87.1.4 (A:) Glycogen phosphorylase {Rabbit (Oryctolagus cuniculus)}
isvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtqq
hyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedaglg
ngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpweka
rpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapndg
yiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfksstnfdafp
dkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvipealerwpvh
lletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlciagsh
avngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaerigee
yisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvqvkri
heykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitaigdvv
nhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlngaltig
tmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqlssgff
spkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirniatsgk
fssdrtiaqyareiwgvepsrqrlpap

SCOP Domain Coordinates for d1k06a_:

Click to download the PDB-style file with coordinates for d1k06a_.
(The format of our PDB-style files is described here.)

Timeline for d1k06a_: