Lineage for d1k05c_ (1k05 C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988268Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1989048Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (2 families) (S)
  5. 1989049Family a.24.14.1: FAT domain of focal adhesion kinase [68994] (2 proteins)
    automatically mapped to Pfam PF03623
  6. 1989050Protein FAT domain of focal adhesion kinase [68995] (3 species)
  7. 1989055Species Human (Homo sapiens) [TaxId:9606] [68996] (5 PDB entries)
  8. 1989065Domain d1k05c_: 1k05 C: [67907]

Details for d1k05c_

PDB Entry: 1k05 (more details), 2.9 Å

PDB Description: Crystal structure of the Focal Adhesion Targeting Domain of Focal Adhesion Kinase
PDB Compounds: (C:) Focal adhesion kinase 1

SCOPe Domain Sequences for d1k05c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k05c_ a.24.14.1 (C:) FAT domain of focal adhesion kinase {Human (Homo sapiens) [TaxId: 9606]}
qeisppptanldrsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtlla
tvdetipllpasthreiemaqkllnsdlgelinkmklaqqyvmtslqqeykkqmltaaha
lavdaknlldvidqarlkmlgq

SCOPe Domain Coordinates for d1k05c_:

Click to download the PDB-style file with coordinates for d1k05c_.
(The format of our PDB-style files is described here.)

Timeline for d1k05c_: