SCOPe 2.06: Domain d1k05b_: 1k05 B:

Lineage for d1k05b_ (1k05 B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (2 families)

5. Family a.24.14.1: FAT domain of focal adhesion kinase [68994] (2 proteins)
   automatically mapped to Pfam PF03623

6. Protein FAT domain of focal adhesion kinase [68995] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [68996] (5 PDB entries)

8. Domain d1k05b_: 1k05 B: [67906]

Details for d1k05b_

PDB Entry: 1k05, 2.9 Å

PDB Description: Crystal structure of the Focal Adhesion Targeting Domain of Focal Adhesion Kinase

PDB Compounds: (B:) Focal adhesion kinase 1

SCOPe Domain Sequences for d1k05b_:

Sequence; same for both SEQRES and ATOM records:

>d1k05b_ a.24.14.1 (B:) FAT domain of focal adhesion kinase {Human (Homo sapiens) [TaxId: 9606]}
pqeisppptanldrsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtll
atvdetipllpasthreiemaqkllnsdlgelinkmklaqqyvmtslqqeykkqmltaah
alavdaknlldvidqarlkmlg

Timeline for d1k05b_:

• d1k05b_ first appeared in SCOP 1.59
  
• d1k05b_ appears in SCOPe 2.05
  
• d1k05b_ appears in SCOPe 2.07
  
• d1k05b_ appears in the current release, SCOPe 2.08