SCOPe 2.05: Domain d1jzwa_: 1jzw A:

Lineage for d1jzwa_ (1jzw A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.12: ArsC-like [69518] (4 proteins)
   Pfam PF03960

6. Protein Arsenate reductase ArsC [69519] (1 species)

7. Species Escherichia coli [TaxId:562] [69520] (4 PDB entries)

8. Domain d1jzwa_: 1jzw A: [67883]
   complexed with cs, so3, so4

Details for d1jzwa_

PDB Entry: 1jzw, 1.76 Å

PDB Description: arsenate reductase + sodium arsenate from e. coli

PDB Compounds: (A:) arsenate reductase

SCOPe Domain Sequences for d1jzwa_:

Sequence; same for both SEQRES and ATOM records:

>d1jzwa_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]}
nitiyhnpacgtsrntlemirnsgteptiilylenppsrdelvkliadmgisvrallrkn
vepyeqlglaedkftddqlidfmlqhpilinrpivvtplgtrlcrpsevvldilqdaqkg
aftkedgekvvdeagkrl

Timeline for d1jzwa_:

• d1jzwa_ first appeared in SCOP 1.59
  
• d1jzwa_ appears in SCOPe 2.04
  
• d1jzwa_ appears in SCOPe 2.06
  
• d1jzwa_ appears in the current release, SCOPe 2.08