SCOPe 2.06: Domain d1jzsa2: 1jzs A:198-386

Lineage for d1jzsa2 (1jzs A:198-386)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily)
   core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel

4. Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family)

5. Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (4 proteins)
   inserted into the catalytic domain

6. Protein Isoleucyl-tRNA synthetase (IleRS) [50679] (2 species)

7. Species Thermus thermophilus [TaxId:274] [50680] (6 PDB entries)

8. Domain d1jzsa2: 1jzs A:198-386 [67881]
   Other proteins in same PDB: d1jzsa1, d1jzsa3
   protein/RNA complex; complexed with mrc, zn

Details for d1jzsa2

PDB Entry: 1jzs, 2.5 Å

PDB Description: Isoleucyl-tRNA synthetase Complexed with mupirocin

PDB Compounds: (A:) isoleucyl-tRNA synthetase

SCOPe Domain Sequences for d1jzsa2:

Sequence; same for both SEQRES and ATOM records:

>d1jzsa2 b.51.1.1 (A:198-386) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]}
keiqdpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdea
lileeglgrkllgegtqvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgi
vhqapafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgllf
keesylhsy

Timeline for d1jzsa2:

• d1jzsa2 first appeared in SCOP 1.59
  
• d1jzsa2 appears in SCOPe 2.05
  
• d1jzsa2 appears in SCOPe 2.07
  
• d1jzsa2 appears in the current release, SCOPe 2.08