Class b: All beta proteins [48724] (177 folds) |
Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily) core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel |
Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) |
Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (4 proteins) inserted into the catalytic domain |
Protein Isoleucyl-tRNA synthetase (IleRS) [50679] (2 species) |
Species Thermus thermophilus [TaxId:274] [50680] (6 PDB entries) |
Domain d1jzsa2: 1jzs A:198-386 [67881] Other proteins in same PDB: d1jzsa1, d1jzsa3 protein/RNA complex; complexed with mrc, zn |
PDB Entry: 1jzs (more details), 2.5 Å
SCOPe Domain Sequences for d1jzsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jzsa2 b.51.1.1 (A:198-386) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} keiqdpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdea lileeglgrkllgegtqvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgi vhqapafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgllf keesylhsy
Timeline for d1jzsa2: