Lineage for d1jzsa2 (1jzs A:198-386)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798370Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily)
    core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel
  4. 1798371Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) (S)
  5. 1798372Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (4 proteins)
    inserted into the catalytic domain
  6. 1798373Protein Isoleucyl-tRNA synthetase (IleRS) [50679] (2 species)
  7. 1798378Species Thermus thermophilus [TaxId:274] [50680] (6 PDB entries)
  8. 1798386Domain d1jzsa2: 1jzs A:198-386 [67881]
    Other proteins in same PDB: d1jzsa1, d1jzsa3
    protein/RNA complex; complexed with mrc, zn

Details for d1jzsa2

PDB Entry: 1jzs (more details), 2.5 Å

PDB Description: Isoleucyl-tRNA synthetase Complexed with mupirocin
PDB Compounds: (A:) isoleucyl-tRNA synthetase

SCOPe Domain Sequences for d1jzsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jzsa2 b.51.1.1 (A:198-386) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]}
keiqdpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdea
lileeglgrkllgegtqvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgi
vhqapafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgllf
keesylhsy

SCOPe Domain Coordinates for d1jzsa2:

Click to download the PDB-style file with coordinates for d1jzsa2.
(The format of our PDB-style files is described here.)

Timeline for d1jzsa2: