Lineage for d1jzsa2 (1jzs A:198-386)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 169418Fold b.51: ValRS/IleRS editing domain [50676] (1 superfamily)
  4. 169419Superfamily b.51.1: ValRS/IleRS editing domain [50677] (1 family) (S)
  5. 169420Family b.51.1.1: ValRS/IleRS editing domain [50678] (2 proteins)
  6. 169421Protein Isoleucyl-tRNA synthetase (IleRS) [50679] (2 species)
  7. 169426Species Thermus thermophilus [TaxId:274] [50680] (3 PDB entries)
  8. 169428Domain d1jzsa2: 1jzs A:198-386 [67881]
    Other proteins in same PDB: d1jzsa1, d1jzsa3

Details for d1jzsa2

PDB Entry: 1jzs (more details), 2.5 Å

PDB Description: Isoleucyl-tRNA synthetase Complexed with mupirocin

SCOP Domain Sequences for d1jzsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jzsa2 b.51.1.1 (A:198-386) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus}
keiqdpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdea
lileeglgrkllgegtqvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgi
vhqapafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgllf
keesylhsy

SCOP Domain Coordinates for d1jzsa2:

Click to download the PDB-style file with coordinates for d1jzsa2.
(The format of our PDB-style files is described here.)

Timeline for d1jzsa2: