Lineage for d1jzsa1 (1jzs A:642-821)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767290Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 767291Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) (S)
  5. 767292Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)
  6. 767307Protein Isoleucyl-tRNA synthetase (IleRS) [47328] (2 species)
  7. 767312Species Thermus thermophilus [TaxId:274] [47329] (3 PDB entries)
  8. 767314Domain d1jzsa1: 1jzs A:642-821 [67880]
    Other proteins in same PDB: d1jzsa2, d1jzsa3
    complexed with mrc, zn

Details for d1jzsa1

PDB Entry: 1jzs (more details), 2.5 Å

PDB Description: Isoleucyl-tRNA synthetase Complexed with mupirocin
PDB Compounds: (A:) isoleucyl-tRNA synthetase

SCOP Domain Sequences for d1jzsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jzsa1 a.27.1.1 (A:642-821) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]}
yfltlwnvysffvtyanldrpdlknppppekrpemdrwllarmqdliqrvtealeaydpt
tsaralrdfvvedlsqwyvrrnrrrfwknedaldreaayatlyealvlvatlaapftpfl
aevlwqnlvrsvrleakesvhladwpeadpaladealvaqmravlkvvdlaraaraksgv

SCOP Domain Coordinates for d1jzsa1:

Click to download the PDB-style file with coordinates for d1jzsa1.
(The format of our PDB-style files is described here.)

Timeline for d1jzsa1: