Class a: All alpha proteins [46456] (284 folds) |
Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) |
Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins) |
Protein Isoleucyl-tRNA synthetase (IleRS) [47328] (2 species) |
Species Thermus thermophilus [TaxId:274] [47329] (3 PDB entries) |
Domain d1jzsa1: 1jzs A:642-821 [67880] Other proteins in same PDB: d1jzsa2, d1jzsa3 complexed with mrc, zn |
PDB Entry: 1jzs (more details), 2.5 Å
SCOP Domain Sequences for d1jzsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jzsa1 a.27.1.1 (A:642-821) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} yfltlwnvysffvtyanldrpdlknppppekrpemdrwllarmqdliqrvtealeaydpt tsaralrdfvvedlsqwyvrrnrrrfwknedaldreaayatlyealvlvatlaapftpfl aevlwqnlvrsvrleakesvhladwpeadpaladealvaqmravlkvvdlaraaraksgv
Timeline for d1jzsa1: