SCOP 1.75: Domain d1jzrc2: 1jzr C:100-200

Lineage for d1jzrc2 (1jzr C:100-200)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (23 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)

6. Protein Yeast prion protein ure2p, nitrogen regulation fragment [52886] (1 species)
   similar to class phi enzymes

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52887] (8 PDB entries)

8. Domain d1jzrc2: 1jzr C:100-200 [67877]
   Other proteins in same PDB: d1jzra1, d1jzrb1, d1jzrc1, d1jzrd1

Details for d1jzrc2

PDB Entry: 1jzr, 2.9 Å

PDB Description: Ure2p in complex with glutathione

PDB Compounds: (C:) ure2 protein

SCOP Domain Sequences for d1jzrc2:

Sequence; same for both SEQRES and ATOM records:

>d1jzrc2 c.47.1.5 (C:100-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sritkffqeqplegytlfshrsapngfkvaivlselgfhyntifldfnlgehrapefvsv
npnarvpalidhgmdnlsiwesgaillhlvnkyyketgnpl

Timeline for d1jzrc2:

• d1jzrc2 first appeared in SCOP 1.59
  
• d1jzrc2 appears in SCOP 1.73
  
• d1jzrc2 appears in SCOPe 2.01
  
• d1jzrc2 appears in the current release, SCOPe 2.08