Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins) contains a conserved all-alpha subdomain at the C-terminal extension |
Protein Isoleucyl-tRNA synthetase (IleRS) [52387] (2 species) |
Species Thermus thermophilus [TaxId:274] [52388] (3 PDB entries) |
Domain d1jzqa3: 1jzq A:1-197,A:387-641 [67871] Other proteins in same PDB: d1jzqa1, d1jzqa2 protein/RNA complex; complexed with ila, zn |
PDB Entry: 1jzq (more details), 3 Å
SCOPe Domain Sequences for d1jzqa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jzqa3 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} mfkevgepnfpkleeevlafwkrekifqksvenrkggprytvyegpptanglphvghaqa rsykdlfpryktmrgyyaprragwdthglpvelevekklglkskreieaygierfnqacr esvftyekeweafteriaywvdledayatleptyiesiwwslknlfdrgllyrdhkvvpy cprcgtplsshevalgyXphcwrcstplmyyateswfikntlfkdelirnnqeihwvpph ikegrygewlknlvdwalsrnrywgtplpiwvcqacgkeeaigsfqelkaratkplpepf dphrpyvdqvelacacggtmrrvpyvidvwydsgampfaslhypfeheevfresfpadfi aegidqtrgwfnslhqlgvmlfgsiafknvichglildekgqkmskskgnvvdpwdiirk fgadalrwyiyvsappeadrrfgpnlvretvrd
Timeline for d1jzqa3: