Lineage for d1jzqa3 (1jzq A:1-197,A:387-641)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1841352Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1841353Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 1841417Protein Isoleucyl-tRNA synthetase (IleRS) [52387] (2 species)
  7. 1841422Species Thermus thermophilus [TaxId:274] [52388] (3 PDB entries)
  8. 1841425Domain d1jzqa3: 1jzq A:1-197,A:387-641 [67871]
    Other proteins in same PDB: d1jzqa1, d1jzqa2
    protein/RNA complex; complexed with ila, zn

Details for d1jzqa3

PDB Entry: 1jzq (more details), 3 Å

PDB Description: Isoleucyl-tRNA synthetase Complexed with Isoleucyl-adenylate analogue
PDB Compounds: (A:) isoleucyl-tRNA synthetase

SCOPe Domain Sequences for d1jzqa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jzqa3 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]}
mfkevgepnfpkleeevlafwkrekifqksvenrkggprytvyegpptanglphvghaqa
rsykdlfpryktmrgyyaprragwdthglpvelevekklglkskreieaygierfnqacr
esvftyekeweafteriaywvdledayatleptyiesiwwslknlfdrgllyrdhkvvpy
cprcgtplsshevalgyXphcwrcstplmyyateswfikntlfkdelirnnqeihwvpph
ikegrygewlknlvdwalsrnrywgtplpiwvcqacgkeeaigsfqelkaratkplpepf
dphrpyvdqvelacacggtmrrvpyvidvwydsgampfaslhypfeheevfresfpadfi
aegidqtrgwfnslhqlgvmlfgsiafknvichglildekgqkmskskgnvvdpwdiirk
fgadalrwyiyvsappeadrrfgpnlvretvrd

SCOPe Domain Coordinates for d1jzqa3:

Click to download the PDB-style file with coordinates for d1jzqa3.
(The format of our PDB-style files is described here.)

Timeline for d1jzqa3: