Lineage for d1jzqa2 (1jzq A:198-386)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 113027Fold b.51: ValRS/IleRS editing domain [50676] (1 superfamily)
  4. 113028Superfamily b.51.1: ValRS/IleRS editing domain [50677] (1 family) (S)
  5. 113029Family b.51.1.1: ValRS/IleRS editing domain [50678] (2 proteins)
  6. 113030Protein Isoleucyl-tRNA synthetase (IleRS) [50679] (2 species)
  7. 113035Species Thermus thermophilus [TaxId:274] [50680] (3 PDB entries)
  8. 113038Domain d1jzqa2: 1jzq A:198-386 [67870]
    Other proteins in same PDB: d1jzqa1, d1jzqa3

Details for d1jzqa2

PDB Entry: 1jzq (more details), 3 Å

PDB Description: Isoleucyl-tRNA synthetase Complexed with Isoleucyl-adenylate analogue

SCOP Domain Sequences for d1jzqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jzqa2 b.51.1.1 (A:198-386) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus}
keiqdpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdea
lileeglgrkllgegtqvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgi
vhqapafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgllf
keesylhsy

SCOP Domain Coordinates for d1jzqa2:

Click to download the PDB-style file with coordinates for d1jzqa2.
(The format of our PDB-style files is described here.)

Timeline for d1jzqa2: