![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily) core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel |
![]() | Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) ![]() |
![]() | Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (4 proteins) inserted into the catalytic domain |
![]() | Protein Isoleucyl-tRNA synthetase (IleRS) [50679] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [50680] (6 PDB entries) |
![]() | Domain d1jzqa2: 1jzq A:198-386 [67870] Other proteins in same PDB: d1jzqa1, d1jzqa3 protein/RNA complex; complexed with ila, zn |
PDB Entry: 1jzq (more details), 3 Å
SCOPe Domain Sequences for d1jzqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jzqa2 b.51.1.1 (A:198-386) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} keiqdpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdea lileeglgrkllgegtqvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgi vhqapafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgllf keesylhsy
Timeline for d1jzqa2: