SCOPe 2.06: Domain d1jzla_: 1jzl A:

Lineage for d1jzla_ (1jzl A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin I [46464] (2 species)

7. Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (37 PDB entries)

8. Domain d1jzla_: 1jzl A: [67865]
   complexed with cmo, hem; mutant

Details for d1jzla_

PDB Entry: 1jzl, 1.5 Å

PDB Description: crystal structure of sapharca inaequivalvis hbi, i114m mutant ligated to carbon monoxide.

PDB Compounds: (A:) Globin I - Ark Shell

SCOPe Domain Sequences for d1jzla_:

Sequence; same for both SEQRES and ATOM records:

>d1jzla_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgnvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkmngpikkv
lasknfgdkyanawaklvavvqaal

Timeline for d1jzla_:

• d1jzla_ first appeared in SCOP 1.59
  
• d1jzla_ appears in SCOPe 2.05
  
• d1jzla_ appears in SCOPe 2.07
  
• d1jzla_ appears in the current release, SCOPe 2.08