Lineage for d1jzla_ (1jzl A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 436026Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 436027Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 436063Family a.1.1.2: Globins [46463] (22 proteins)
    Heme-binding protein
  6. 436138Protein Hemoglobin I [46464] (2 species)
  7. 436139Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (17 PDB entries)
  8. 436144Domain d1jzla_: 1jzl A: [67865]

Details for d1jzla_

PDB Entry: 1jzl (more details), 1.5 Å

PDB Description: crystal structure of sapharca inaequivalvis hbi, i114m mutant ligated to carbon monoxide.

SCOP Domain Sequences for d1jzla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jzla_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis)}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgnvsqgm
andklrghsitlmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkmngpikkv
lasknfgdkyanawaklvavvqaal

SCOP Domain Coordinates for d1jzla_:

Click to download the PDB-style file with coordinates for d1jzla_.
(The format of our PDB-style files is described here.)

Timeline for d1jzla_: