Lineage for d1jz8d5 (1jz8 D:334-625)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 116348Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 116528Family c.1.8.3: beta-glycanases [51487] (13 proteins)
  6. 116533Protein beta-Galactosidase, domain 3 [51510] (1 species)
  7. 116534Species Escherichia coli [TaxId:562] [51511] (23 PDB entries)
  8. 116538Domain d1jz8d5: 1jz8 D:334-625 [67849]
    Other proteins in same PDB: d1jz8a1, d1jz8a2, d1jz8a3, d1jz8a4, d1jz8b1, d1jz8b2, d1jz8b3, d1jz8b4, d1jz8c1, d1jz8c2, d1jz8c3, d1jz8c4, d1jz8d1, d1jz8d2, d1jz8d3, d1jz8d4

Details for d1jz8d5

PDB Entry: 1jz8 (more details), 1.5 Å

PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with allolactose

SCOP Domain Sequences for d1jz8d5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz8d5 c.1.8.3 (D:334-625) beta-Galactosidase, domain 3 {Escherichia coli}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilcqyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOP Domain Coordinates for d1jz8d5:

Click to download the PDB-style file with coordinates for d1jz8d5.
(The format of our PDB-style files is described here.)

Timeline for d1jz8d5: