Lineage for d1jz8c5 (1jz8 C:334-625)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173209Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 173428Family c.1.8.3: beta-glycanases [51487] (14 proteins)
  6. 173433Protein beta-Galactosidase, domain 3 [51510] (1 species)
  7. 173434Species Escherichia coli [TaxId:562] [51511] (23 PDB entries)
  8. 173437Domain d1jz8c5: 1jz8 C:334-625 [67844]
    Other proteins in same PDB: d1jz8a1, d1jz8a2, d1jz8a3, d1jz8a4, d1jz8b1, d1jz8b2, d1jz8b3, d1jz8b4, d1jz8c1, d1jz8c2, d1jz8c3, d1jz8c4, d1jz8d1, d1jz8d2, d1jz8d3, d1jz8d4

Details for d1jz8c5

PDB Entry: 1jz8 (more details), 1.5 Å

PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with allolactose

SCOP Domain Sequences for d1jz8c5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz8c5 c.1.8.3 (C:334-625) beta-Galactosidase, domain 3 {Escherichia coli}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilcqyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOP Domain Coordinates for d1jz8c5:

Click to download the PDB-style file with coordinates for d1jz8c5.
(The format of our PDB-style files is described here.)

Timeline for d1jz8c5: