Lineage for d1jz8c4 (1jz8 C:731-1023)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2052444Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2052583Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2052584Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 2052585Protein beta-Galactosidase, domain 5 [49996] (2 species)
  7. 2052593Species Escherichia coli [TaxId:562] [49997] (42 PDB entries)
    Uniprot P00722
  8. 2052596Domain d1jz8c4: 1jz8 C:731-1023 [67843]
    Other proteins in same PDB: d1jz8a1, d1jz8a2, d1jz8a3, d1jz8a5, d1jz8b1, d1jz8b2, d1jz8b3, d1jz8b5, d1jz8c1, d1jz8c2, d1jz8c3, d1jz8c5, d1jz8d1, d1jz8d2, d1jz8d3, d1jz8d5
    complexed with dms, lak, mg, na, tar

Details for d1jz8c4

PDB Entry: 1jz8 (more details), 1.5 Å

PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with allolactose
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d1jz8c4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz8c4 b.30.5.1 (C:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d1jz8c4:

Click to download the PDB-style file with coordinates for d1jz8c4.
(The format of our PDB-style files is described here.)

Timeline for d1jz8c4: